PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676737382
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family ZF-HD
Protein Properties Length: 312aa    MW: 34148.9 Da    PI: 8.5858
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676737382genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer102.33.2e-3269124258
  ZF-HD_dimer   2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 
                  ++vrY+eClkNhAa++Gg + DGCgEfmps geegt++al+CaAC+CHRnFHR+e++
    676737382  69 TTVRYRECLKNHAANVGGSVHDGCGEFMPS-GEEGTIEALRCAACDCHRNFHRKEMD 124
                  689**************************9.999********************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047702.7E-2971123IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015667.2E-3072123IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257745.0E-2672124IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.0373122IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466891.36E-19227301IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.2E-31232301IPR009057Homeodomain-like
PROSITE profilePS500718.616238302IPR001356Homeobox domain
TIGRFAMsTIGR015651.3E-29240297IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MDMRSHEMIE RRRDDNGVGN INSIANEDNC NGNNNNNNNN TRVSCNSQTL DHHQSKSPSS  60
FSVSAASKTT VRYRECLKNH AANVGGSVHD GCGEFMPSGE EGTIEALRCA ACDCHRNFHR  120
KEMDGVGSSD VMAHHRHHHH HHQYGGSGGG GRRPPPPNMM LNPLMLPPPP NYTPMHHHKY  180
GMSPTGGGGM VTPMSVAYGG SGGGGGAESS SEDLNLYGQS SGEHGGGGTA GQMAFSMSSK  240
KRFRTKFTTE QKERMMEFAE KLGWRMNKQD EEELKRFCGE IGVKRQVFKV WMHNNKNNAR  300
KPPPITTTAA TL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A5e-232392991676ZF-HD homeobox family protein
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00238DAPTransfer from AT1G75240Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1894930.0AC189493.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB084P16, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013699323.11e-151PREDICTED: zinc-finger homeodomain protein 5-like
SwissprotQ9FRL51e-128ZHD5_ARATH; Zinc-finger homeodomain protein 5
TrEMBLA0A078C8I81e-151A0A078C8I8_BRANA; BnaC06g36000D protein
STRINGBra015857.1-P1e-146(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM72792543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75240.11e-108homeobox protein 33